Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (1 family) |
Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (1 protein) |
Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (2 species) |
Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [56853] (1 PDB entry) |
Domain d1ciy_3: 1ciy 33-255 [43392] Other proteins in same PDB: d1ciy_1, d1ciy_2 |
PDB Entry: 1ciy (more details), 2.25 Å
SCOP Domain Sequences for d1ciy_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciy_3 f.1.3.1 (33-255) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRYIA (A)} ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaipllavqn yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwyn tglervwgpdsrdwvrynqfrreltltvldivalfsnydsrry
Timeline for d1ciy_3: