Lineage for d1ciy_3 (1ciy 33-255)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38778Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
  4. 38804Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (1 family) (S)
  5. 38805Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (1 protein)
  6. 38806Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (2 species)
  7. 38809Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [56853] (1 PDB entry)
  8. 38810Domain d1ciy_3: 1ciy 33-255 [43392]
    Other proteins in same PDB: d1ciy_1, d1ciy_2

Details for d1ciy_3

PDB Entry: 1ciy (more details), 2.25 Å

PDB Description: insecticidal toxin: structure and channel formation

SCOP Domain Sequences for d1ciy_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciy_3 f.1.3.1 (33-255) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRYIA (A)}
ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa
rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaipllavqn
yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwyn
tglervwgpdsrdwvrynqfrreltltvldivalfsnydsrry

SCOP Domain Coordinates for d1ciy_3:

Click to download the PDB-style file with coordinates for d1ciy_3.
(The format of our PDB-style files is described here.)

Timeline for d1ciy_3: