Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family) |
Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein) |
Protein Diphtheria toxin, middle domain [56847] (1 species) contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A) |
Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries) |
Domain d1xdtt3: 1xdt T:200-380 [43390] Other proteins in same PDB: d1xdtr_, d1xdtt1, d1xdtt2 |
PDB Entry: 1xdt (more details), 2.65 Å
SCOP Domain Sequences for d1xdtt3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdtt3 f.1.2.1 (T:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa y
Timeline for d1xdtt3: