Lineage for d1xdtt3 (1xdt T:200-380)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886032Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 886048Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family) (S)
  5. 886049Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)
  6. 886050Protein Diphtheria toxin, middle domain [56847] (1 species)
    contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)
  7. 886051Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries)
  8. 886060Domain d1xdtt3: 1xdt T:200-380 [43390]
    Other proteins in same PDB: d1xdtr_, d1xdtt1, d1xdtt2

Details for d1xdtt3

PDB Entry: 1xdt (more details), 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor
PDB Compounds: (T:) diphtheria toxin

SCOP Domain Sequences for d1xdtt3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdtt3 f.1.2.1 (T:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

SCOP Domain Coordinates for d1xdtt3:

Click to download the PDB-style file with coordinates for d1xdtt3.
(The format of our PDB-style files is described here.)

Timeline for d1xdtt3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xdtr_