Lineage for d1mdtb3 (1mdt B:200-380)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626604Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 2626605Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)
  6. 2626606Protein Diphtheria toxin, middle domain [56847] (1 species)
    contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)
  7. 2626607Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)
  8. 2626612Domain d1mdtb3: 1mdt B:200-380 [43387]
    Other proteins in same PDB: d1mdta1, d1mdta2, d1mdtb1, d1mdtb2
    complexed with apu

Details for d1mdtb3

PDB Entry: 1mdt (more details), 2.3 Å

PDB Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d1mdtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdtb3 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

SCOPe Domain Coordinates for d1mdtb3:

Click to download the PDB-style file with coordinates for d1mdtb3.
(The format of our PDB-style files is described here.)

Timeline for d1mdtb3: