SCOPe 2.08: Domain d1mdtb3: 1mdt B:200-380

Lineage for d1mdtb3 (1mdt B:200-380)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)

6. Protein Diphtheria toxin, middle domain [56847] (1 species)
   contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)

7. Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)

8. Domain d1mdtb3: 1mdt B:200-380 [43387]
   Other proteins in same PDB: d1mdta1, d1mdta2, d1mdtb1, d1mdtb2
   complexed with apu

Details for d1mdtb3

PDB Entry: 1mdt, 2.3 Å

PDB Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d1mdtb3:

Sequence; same for both SEQRES and ATOM records:

>d1mdtb3 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Timeline for d1mdtb3:

• d1mdtb3 first appeared (with stable ids) in SCOP 1.55
  
• d1mdtb3 appears in SCOPe 2.07