Lineage for d1sgk_3 (1sgk 200-380)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87529Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
  4. 87542Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family) (S)
  5. 87543Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)
  6. 87544Protein Diphtheria toxin, middle domain [56847] (1 species)
  7. 87545Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries)
  8. 87549Domain d1sgk_3: 1sgk 200-380 [43385]
    Other proteins in same PDB: d1sgk_1, d1sgk_2

Details for d1sgk_3

PDB Entry: 1sgk (more details), 2.3 Å

PDB Description: nucleotide-free diphtheria toxin

SCOP Domain Sequences for d1sgk_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgk_3 f.1.2.1 (200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

SCOP Domain Coordinates for d1sgk_3:

Click to download the PDB-style file with coordinates for d1sgk_3.
(The format of our PDB-style files is described here.)

Timeline for d1sgk_3: