Lineage for d1sgk_3 (1sgk 200-380)
- Root: SCOP 1.57
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family) 
Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein) Protein Diphtheria toxin, middle domain [56847] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries) 
Domain d1sgk_3: 1sgk 200-380 [43385]
Other proteins in same PDB: d1sgk_1, d1sgk_2
Details for d1sgk_3
PDB Entry: 1sgk (more details), 2.3 Å
PDB Description: nucleotide-free diphtheria toxin
SCOP Domain Sequences for d1sgk_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgk_3 f.1.2.1 (200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y
SCOP Domain Coordinates for d1sgk_3:
Click to download the PDB-style file with coordinates for d1sgk_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sgk_3:
- d1sgk_3 first appeared (with stable ids) in SCOP 1.55
- d1sgk_3 appears in SCOP 1.59
- d1sgk_3 appears in the current release, SCOPe 2.08, called d1sgka3
View in 3D
