SCOPe 2.07: Domain d1f0la3: 1f0l A:201-380

Lineage for d1f0la3 (1f0l A:201-380)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)

6. Protein Diphtheria toxin, middle domain [56847] (1 species)
   contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)

7. Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)

8. Domain d1f0la3: 1f0l A:201-380 [43382]
   Other proteins in same PDB: d1f0la1, d1f0la2, d1f0lb1, d1f0lb2
   complexed with apu, cl

Details for d1f0la3

PDB Entry: 1f0l, 1.55 Å

PDB Description: 1.55 angstrom crystal structure of wild type diphtheria toxin

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d1f0la3:

Sequence, based on SEQRES records:

>d1f0la3 f.1.2.1 (A:201-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay

Sequence, based on observed residues (ATOM records):

>d1f0la3 f.1.2.1 (A:201-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgeligfaaynfvesiinlfqvvhnsynrpay

Timeline for d1f0la3:

• d1f0la3 first appeared (with stable ids) in SCOP 1.55
  
• d1f0la3 appears in SCOPe 2.06
  
• d1f0la3 appears in the current release, SCOPe 2.08