Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) automatically mapped to Pfam PF02764 |
Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein) |
Protein Diphtheria toxin, middle domain [56847] (1 species) contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A) |
Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries) |
Domain d1f0la3: 1f0l A:201-380 [43382] Other proteins in same PDB: d1f0la1, d1f0la2, d1f0lb1, d1f0lb2 complexed with apu, cl |
PDB Entry: 1f0l (more details), 1.55 Å
SCOPe Domain Sequences for d1f0la3:
Sequence, based on SEQRES records: (download)
>d1f0la3 f.1.2.1 (A:201-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]} cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay
>d1f0la3 f.1.2.1 (A:201-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]} cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga vhhnteeivaqsialsslmvaqaiplvgeligfaaynfvesiinlfqvvhnsynrpay
Timeline for d1f0la3: