Lineage for d1amub_ (1amu B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573817Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2573818Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2573819Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2573883Protein Phenylalanine activating domain of gramicidin synthetase 1 [56805] (1 species)
  7. 2573884Species Bacillus brevis [TaxId:1393] [56806] (1 PDB entry)
  8. 2573886Domain d1amub_: 1amu B: [43352]
    complexed with amp, mg, phe, so4

Details for d1amub_

PDB Entry: 1amu (more details), 1.9 Å

PDB Description: phenylalanine activating domain of gramicidin synthetase 1 in a complex with amp and phenylalanine
PDB Compounds: (B:) gramicidin synthetase 1

SCOPe Domain Sequences for d1amub_:

Sequence, based on SEQRES records: (download)

>d1amub_ e.23.1.1 (B:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]}
gtheeeqylfavnntkaeyprdktihqlfeeqvskrpnnvaivceneqltyhelnvkanq
larifiekgigkdtlvgimmeksidlfigilavlkaggayvpidieypkeriqyilddsq
armlltqkhlvhlihniqfngqveifeedtikiregtnlhvpskstdlayviytsgttgn
pkgtmlehkgisnlkvffenslnvtekdrigqfasisfdasvwemfmalltgaslyiilk
dtindfvkfeqyinqkeitvitlpptyvvhldperilsiqtlitagsatspslvnkwkek
vtyinaygptetticattwvatketighsvpigapiqntqiyivdenlqlksvgeagelc
iggeglargywkrpeltsqkfvdnpfvpgeklyktgdqarwlsdgnieylgridnqvkir
ghrveleevesillkhmyisetavsvhkdhqeqpylcayfvsekhipleqlrqfsseelp
tymipsyfiqldkmpltsngkidrkqlpepdltf

Sequence, based on observed residues (ATOM records): (download)

>d1amub_ e.23.1.1 (B:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]}
gtheeeqylfavnntkaeyprdktihqlfeeqvskrpnnvaivceneqltyhelnvkanq
larifiekgigkdtlvgimmeksidlfigilavlkaggayvpidieypkeriqyilddsq
armlltqkhlvhlihnqfngqveifeedtikiregtnlhvpskstdlayviytnpkgtml
ehkgisnlkvffenslnvtekdrigqfasisfdasvwemfmalltgaslyiilkdtindf
vkfeqyinqkeitvitlpptyvvhldperilsiqtlitagsatspslvnkwkekvtyina
ygptetticattwvatketighsvpigapiqntqiyivdenlqlksvgeagelciggegl
argywkrpeltsqkfvdnpfvpgeklyktgdqarwlsdgnieylgridnqvkirghrvel
eevesillkhmyisetavsvhkdhqeqpylcayfvsekhipleqlrqfsseelptymips
yfiqldkmpltsngkidrkqlpepdltf

SCOPe Domain Coordinates for d1amub_:

Click to download the PDB-style file with coordinates for d1amub_.
(The format of our PDB-style files is described here.)

Timeline for d1amub_: