Lineage for d1ba3a_ (1ba3 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573817Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2573818Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2573819Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins)
  6. 2573870Protein Luciferase [56803] (2 species)
  7. 2573871Species Firefly (Photinus pyralis) [TaxId:7054] [56804] (6 PDB entries)
  8. 2573874Domain d1ba3a_: 1ba3 A: [43350]
    complexed with mbr

Details for d1ba3a_

PDB Entry: 1ba3 (more details), 2.2 Å

PDB Description: firefly luciferase in complex with bromoform
PDB Compounds: (A:) luciferase

SCOPe Domain Sequences for d1ba3a_:

Sequence, based on SEQRES records: (download)

>d1ba3a_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]}
daknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvr
laeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisq
ptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfv
pesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvp
fhhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlid
kydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgav
gkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgd
iaywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpa
avvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilika
kk

Sequence, based on observed residues (ATOM records): (download)

>d1ba3a_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]}
daknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvr
laeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisq
ptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfv
pesfdrdktialimnsstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpfh
hgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidky
dlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgk
vvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdia
ywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaav
vvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikakk

SCOPe Domain Coordinates for d1ba3a_:

Click to download the PDB-style file with coordinates for d1ba3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ba3a_: