Lineage for d1dkya_ (1dky A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339753Fold e.20: Heat shock protein 70kD (HSP70), C-terminal substrate-binding fragment [56777] (1 superfamily)
    2 domains: (1) beta-sandwich: 8 strands in 2 sheets; (2) alpha-helical bundle
  4. 339754Superfamily e.20.1: Heat shock protein 70kD (HSP70), C-terminal substrate-binding fragment [56778] (1 family) (S)
  5. 339755Family e.20.1.1: Heat shock protein 70kD (HSP70), C-terminal substrate-binding fragment [56779] (1 protein)
  6. 339756Protein DnaK [56780] (2 species)
  7. 339757Species Escherichia coli [TaxId:562] [56781] (6 PDB entries)
  8. 339760Domain d1dkya_: 1dky A: [43316]

Details for d1dkya_

PDB Entry: 1dky (more details), 2.8 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals

SCOP Domain Sequences for d1dkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkya_ e.20.1.1 (A:) DnaK {Escherichia coli}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
ltaletalkgedkaaieakmqelaqvsqklm

SCOP Domain Coordinates for d1dkya_:

Click to download the PDB-style file with coordinates for d1dkya_.
(The format of our PDB-style files is described here.)

Timeline for d1dkya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dkyb_