Lineage for d1kanb_ (1kan B:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200959Family e.9.1.3: Kanamycin nucleotidyltransferase (KNTase) [56708] (1 protein)
  6. 200960Protein Kanamycin nucleotidyltransferase (KNTase) [56709] (1 species)
  7. 200961Species Staphylococcus aureus [TaxId:1280] [56710] (2 PDB entries)
  8. 200965Domain d1kanb_: 1kan B: [43235]

Details for d1kanb_

PDB Entry: 1kan (more details), 3 Å

PDB Description: molecular structure of kanamycin nucleotidyltransferase determined to 3.0-angstroms resolution

SCOP Domain Sequences for d1kanb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kanb_ e.9.1.3 (B:) Kanamycin nucleotidyltransferase (KNTase) {Staphylococcus aureus}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfyseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaksveaqkfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
hgyivdvskripf

SCOP Domain Coordinates for d1kanb_:

Click to download the PDB-style file with coordinates for d1kanb_.
(The format of our PDB-style files is described here.)

Timeline for d1kanb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kana_