Lineage for d1knyb_ (1kny B:)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) 
Fold e.9: Nucleotidyltransferases [56698] (1 superfamily) Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) 
Family e.9.1.3: Kanamycin nucleotidyltransferase (KNTase) [56708] (1 protein) Protein Kanamycin nucleotidyltransferase (KNTase) [56709] (1 species) Species Staphylococcus aureus [TaxId:1280] [56710] (2 PDB entries) 
Domain d1knyb_: 1kny B: [43233]
Details for d1knyb_
PDB Entry: 1kny (more details), 2.5 Å
PDB Description: kanamycin nucleotidyltransferase
SCOP Domain Sequences for d1knyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knyb_ e.9.1.3 (B:) Kanamycin nucleotidyltransferase (KNTase) {Staphylococcus aureus}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfyseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaksveaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglh
hricyttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewter
hgyivdvskripf
SCOP Domain Coordinates for d1knyb_:
Click to download the PDB-style file with coordinates for d1knyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1knyb_:
- d1knyb_ first appeared (with stable ids) in SCOP 1.55
- d1knyb_ appears in SCOP 1.59
- d1knyb_ does not appear in SCOP 1.63
View in 3D
