Lineage for d1f5aa2 (1f5a A:20-364)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200952Family e.9.1.2: Poly(A) polymerase, catalytic domain [56704] (1 protein)
  6. 200953Protein Poly(A) polymerase, catalytic domain [56705] (2 species)
  7. 200957Species Cow (Bos taurus) [TaxId:9913] [56707] (1 PDB entry)
  8. 200958Domain d1f5aa2: 1f5a A:20-364 [43231]
    Other proteins in same PDB: d1f5aa1

Details for d1f5aa2

PDB Entry: 1f5a (more details), 2.5 Å

PDB Description: crystal structure of mammalian poly(a) polymerase

SCOP Domain Sequences for d1f5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5aa2 e.9.1.2 (A:20-364) Poly(A) polymerase, catalytic domain {Cow (Bos taurus)}
ygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewirei
sesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklkl
qeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldircir
slngcrvtdeilhlvpnidnfrltlraiklwakrhniysnilgflggvswamlvartcql
ypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpa
ypqqnstynvsvstrmvmveefkqglaitdeillskaewsklfea

SCOP Domain Coordinates for d1f5aa2:

Click to download the PDB-style file with coordinates for d1f5aa2.
(The format of our PDB-style files is described here.)

Timeline for d1f5aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f5aa1