Lineage for d1fa0b2 (1fa0 B:2-351)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200952Family e.9.1.2: Poly(A) polymerase, catalytic domain [56704] (1 protein)
  6. 200953Protein Poly(A) polymerase, catalytic domain [56705] (2 species)
  7. 200954Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56706] (1 PDB entry)
  8. 200956Domain d1fa0b2: 1fa0 B:2-351 [43230]
    Other proteins in same PDB: d1fa0a1, d1fa0b1

Details for d1fa0b2

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp

SCOP Domain Sequences for d1fa0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa0b2 e.9.1.2 (B:2-351) Poly(A) polymerase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae)}
ssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqr
fvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfd
sllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnld
ekdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlva
ricqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmp
vitpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfek

SCOP Domain Coordinates for d1fa0b2:

Click to download the PDB-style file with coordinates for d1fa0b2.
(The format of our PDB-style files is described here.)

Timeline for d1fa0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fa0b1