Lineage for d1zqx__ (1zqx -)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141159Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 141160Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 141161Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 141162Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 141254Species Rat (Rattus norvegicus) [TaxId:10116] [56703] (17 PDB entries)
  8. 141265Domain d1zqx__: 1zqx - [43217]

Details for d1zqx__

PDB Entry: 1zqx (more details), 2.5 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of kcl (150 millimolar)

SCOP Domain Sequences for d1zqx__:

Sequence, based on SEQRES records: (download)

>d1zqx__ e.9.1.1 (-) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
lhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvl
yftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrep
kdrse

Sequence, based on observed residues (ATOM records): (download)

>d1zqx__ e.9.1.1 (-) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
lhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvlyft
gsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
se

SCOP Domain Coordinates for d1zqx__:

Click to download the PDB-style file with coordinates for d1zqx__.
(The format of our PDB-style files is described here.)

Timeline for d1zqx__: