Lineage for d1rpl__ (1rpl -)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200829Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 200830Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 200922Species Rat (Rattus norvegicus) [TaxId:10116] [56703] (17 PDB entries)
  8. 200924Domain d1rpl__: 1rpl - [43212]

Details for d1rpl__

PDB Entry: 1rpl (more details), 2.3 Å

PDB Description: 2.3 angstroms crystal structure of the catalytic domain of dna polymerase beta

SCOP Domain Sequences for d1rpl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpl__ e.9.1.1 (-) DNA polymerase beta, catalytic (31 kD) fragment {Rat (Rattus norvegicus)}
ssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekripree
mlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkllhrv
veqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvlyftg
sdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdrs
e

SCOP Domain Coordinates for d1rpl__:

Click to download the PDB-style file with coordinates for d1rpl__.
(The format of our PDB-style files is described here.)

Timeline for d1rpl__: