Lineage for d9icea2 (9ice A:92-335)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.9: Nucleotidyltransferases [56698] (1 superfamily) Superfamily e.9.1: Nucleotidyltransferases [56699] (3 families) 
Family e.9.1.1: DNA polymerase beta, catalytic (31 kD) fragment [56700] (1 protein) Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56702] (90 PDB entries) 
Domain d9icea2: 9ice A:92-335 [43209]
Other proteins in same PDB: d9icea1
Details for d9icea2
PDB Entry: 9ice (more details), 3.3 Å
PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of datp (1 millimolar) and cucl2 (0.1 millimolar)
SCOP Domain Sequences for d9icea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d9icea2 e.9.1.1 (A:92-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfekrip
reemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqpkll
hqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyrepk
drse
SCOP Domain Coordinates for d9icea2:
Click to download the PDB-style file with coordinates for d9icea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9icea2:
- d9icea2 appears in SCOP 1.57
- d9icea2 last appears in SCOP 1.61
View in 3D
