Lineage for d8icna2 (8icn A:92-335)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141159Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 141160Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 141161Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 141162Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 141163Species Human (Homo sapiens) [TaxId:9606] [56702] (90 PDB entries)
  8. 141187Domain d8icna2: 8icn A:92-335 [43141]
    Other proteins in same PDB: d8icna1

Details for d8icna2

PDB Entry: 8icn (more details), 2.8 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of atp (1 millimolar) and mncl2 (5 millimolar)

SCOP Domain Sequences for d8icna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icna2 e.9.1.1 (A:92-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfekrip
reemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqpkll
hqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyrepk
drse

SCOP Domain Coordinates for d8icna2:

Click to download the PDB-style file with coordinates for d8icna2.
(The format of our PDB-style files is described here.)

Timeline for d8icna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d8icna1