Lineage for d9icva2 (9icv A:92-335)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200827Fold e.9: Nucleotidyltransferases [56698] (1 superfamily)
  4. 200828Superfamily e.9.1: Nucleotidyltransferases [56699] (4 families) (S)
  5. 200829Family e.9.1.1: DNA polymerase beta-like [56700] (3 proteins)
  6. 200830Protein DNA polymerase beta, catalytic (31 kD) fragment [56701] (2 species)
  7. 200831Species Human (Homo sapiens) [TaxId:9606] [56702] (90 PDB entries)
  8. 200850Domain d9icva2: 9icv A:92-335 [43138]
    Other proteins in same PDB: d9icva1

Details for d9icva2

PDB Entry: 9icv (more details), 2.7 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-triphosphate, soaked in the presence of datp and zncl2

SCOP Domain Sequences for d9icva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icva2 e.9.1.1 (A:92-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfekrip
reemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqpkll
hqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyrepk
drse

SCOP Domain Coordinates for d9icva2:

Click to download the PDB-style file with coordinates for d9icva2.
(The format of our PDB-style files is described here.)

Timeline for d9icva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d9icva1