Lineage for d1c9rb1 (1c9r B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38265Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 38266Protein HIV-1 reverse transcriptase [56689] (1 species)
  7. 38267Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (40 PDB entries)
  8. 38346Domain d1c9rb1: 1c9r B: [43109]
    Other proteins in same PDB: d1c9ra1, d1c9rh1, d1c9rh2, d1c9rl1, d1c9rl2

Details for d1c9rb1

PDB Entry: 1c9r (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1c9rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9rb1 e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklapgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfweaalgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkaqnpdivi
yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwa
aaaaaaaaaaaatvndiqklvgklnwaaqiypgiaaaalsaalagtkaltaaapltaaaa
lelaanraaaaaaaagvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvalwyale

SCOP Domain Coordinates for d1c9rb1:

Click to download the PDB-style file with coordinates for d1c9rb1.
(The format of our PDB-style files is described here.)

Timeline for d1c9rb1: