Lineage for d1ep4b_ (1ep4 B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266689Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 266690Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 266747Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 266748Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 266749Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 266792Domain d1ep4b_: 1ep4 B: [43093]
    Other proteins in same PDB: d1ep4a1
    complexed with s11

Details for d1ep4b_

PDB Entry: 1ep4 (more details), 2.5 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with S-1153

SCOP Domain Sequences for d1ep4b_:

Sequence, based on SEQRES records: (download)

>d1ep4b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf
rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym
ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi
vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela
enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd
vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk
lwy

Sequence, based on observed residues (ATOM records): (download)

>d1ep4b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
kkdstkwrklvdfrelnkrtqdfwhpaglkkkksvtvldvgdayfsvpldedfrkytaft
ipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgs
dleigqhrtkieelrqhllrwgltyelhpdkwtvqpivlpekdswtvndiqklvgklnwa
sqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdlia
eiqkqgqgqwtyqiyqepfknlktgkyartndvkqlteavqkittesiviwgktpkfklp
iqketwetwwteywqatwipewefvntpplvklwy

SCOP Domain Coordinates for d1ep4b_:

Click to download the PDB-style file with coordinates for d1ep4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ep4b_: