SCOPe 2.02: Domain d1uwbb_: 1uwb B:

Lineage for d1uwbb_ (1uwb B:)

1. Root: SCOPe 2.02

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (114 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1uwbb_: 1uwb B: [43063]
   Other proteins in same PDB: d1uwba1
   complexed with tbo

Details for d1uwbb_

PDB Entry: 1uwb, 3.2 Å

PDB Description: tyr 181 cys hiv-1 rt/8-cl tibo

PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1uwbb_:

Sequence; same for both SEQRES and ATOM records:

>d1uwbb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
cqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d1uwbb_:

• d1uwbb_ first appeared (with stable ids) in SCOP 1.55, called d1uwbb1
  
• d1uwbb_ appears in SCOPe 2.01
  
• d1uwbb_ appears in SCOPe 2.03
  
• d1uwbb_ appears in the current release, SCOPe 2.08