Lineage for d1bqmb_ (1bqm B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618313Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 618314Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (83 PDB entries)
  8. 618469Domain d1bqmb_: 1bqm B: [43061]
    Other proteins in same PDB: d1bqma1
    complexed with hby; mutant

Details for d1bqmb_

PDB Entry: 1bqm (more details), 3.1 Å

PDB Description: hiv-1 rt/hby 097

SCOP Domain Sequences for d1bqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqmb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

SCOP Domain Coordinates for d1bqmb_:

Click to download the PDB-style file with coordinates for d1bqmb_.
(The format of our PDB-style files is described here.)

Timeline for d1bqmb_: