Lineage for d1bqmb1 (1bqm B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38265Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 38266Protein HIV-1 reverse transcriptase [56689] (1 species)
  7. 38267Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (40 PDB entries)
  8. 38336Domain d1bqmb1: 1bqm B: [43061]
    Other proteins in same PDB: d1bqma1

Details for d1bqmb1

PDB Entry: 1bqm (more details), 3.1 Å

PDB Description: hiv-1 rt/hby 097

SCOP Domain Sequences for d1bqmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqmb1 e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

SCOP Domain Coordinates for d1bqmb1:

Click to download the PDB-style file with coordinates for d1bqmb1.
(The format of our PDB-style files is described here.)

Timeline for d1bqmb1: