Lineage for d1rtdc2 (1rtd C:1-429)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1234135Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1234136Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1234302Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1234303Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1234322Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (114 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1234485Domain d1rtdc2: 1rtd C:1-429 [43050]
    Other proteins in same PDB: d1rtda1, d1rtdc1
    protein/DNA complex; complexed with mg, ttp

Details for d1rtdc2

PDB Entry: 1rtd (more details), 3.2 Å

PDB Description: structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
PDB Compounds: (C:) protein (reverse transcriptase)

SCOPe Domain Sequences for d1rtdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtdc2 e.8.1.2 (C:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
kispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1rtdc2:

Click to download the PDB-style file with coordinates for d1rtdc2.
(The format of our PDB-style files is described here.)

Timeline for d1rtdc2: