SCOP 1.69: Domain d1rtdc2: 1rtd C:1-429

Lineage for d1rtdc2 (1rtd C:1-429)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (78 PDB entries)

8. Domain d1rtdc2: 1rtd C:1-429 [43050]
   Other proteins in same PDB: d1rtda1, d1rtdc1

Details for d1rtdc2

PDB Entry: 1rtd, 3.2 Å

PDB Description: structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance

SCOP Domain Sequences for d1rtdc2:

Sequence; same for both SEQRES and ATOM records:

>d1rtdc2 e.8.1.2 (C:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
kispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d1rtdc2:

• d1rtdc2 first appeared (with stable ids) in SCOP 1.55
  
• d1rtdc2 appears in SCOP 1.67
  
• d1rtdc2 appears in SCOP 1.71
  
• d1rtdc2 appears in the current release, SCOPe 2.08