Lineage for d1revb1 (1rev B:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200579Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 200580Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 200637Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 200638Protein HIV-1 reverse transcriptase [56689] (1 species)
  7. 200639Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (56 PDB entries)
  8. 200666Domain d1revb1: 1rev B: [43037]
    Other proteins in same PDB: d1reva1

Details for d1revb1

PDB Entry: 1rev (more details), 2.6 Å

PDB Description: hiv-1 reverse transcriptase

SCOP Domain Sequences for d1revb1:

Sequence, based on SEQRES records: (download)

>d1revb1 e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
aikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviy
qymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtv
qpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeael
elaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgah
tndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpp
lvklwyq

Sequence, based on observed residues (ATOM records): (download)

>d1revb1 e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
aikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpld
edfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviy
qymddlyvgsdleigqhrtkieelrqhllrwgltgyelhpdkwtvqpivlpekdswtvnd
iqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhg
vyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkit
tesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq

SCOP Domain Coordinates for d1revb1:

Click to download the PDB-style file with coordinates for d1revb1.
(The format of our PDB-style files is described here.)

Timeline for d1revb1: