Lineage for d1vrub_ (1vru B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266689Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 266690Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 266747Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 266748Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 266749Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 266756Domain d1vrub_: 1vru B: [43027]
    Other proteins in same PDB: d1vrua1
    complexed with aap, cya

Details for d1vrub_

PDB Entry: 1vru (more details), 2.4 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes

SCOP Domain Sequences for d1vrub_:

Sequence, based on SEQRES records: (download)

>d1vrub_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
mddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
ivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelel
aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
klwyq

Sequence, based on observed residues (ATOM records): (download)

>d1vrub_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
mddlyvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvnd
iqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhg
vyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyargahtndvkqlteavqkitte
siviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq

SCOP Domain Coordinates for d1vrub_:

Click to download the PDB-style file with coordinates for d1vrub_.
(The format of our PDB-style files is described here.)

Timeline for d1vrub_: