Lineage for d1vrua2 (1vru A:3-429)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200579Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 200580Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 200637Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 200638Protein HIV-1 reverse transcriptase [56689] (1 species)
  7. 200639Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (56 PDB entries)
  8. 200645Domain d1vrua2: 1vru A:3-429 [43026]
    Other proteins in same PDB: d1vrua1

Details for d1vrua2

PDB Entry: 1vru (more details), 2.4 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes

SCOP Domain Sequences for d1vrua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrua2 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele
laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
vklwyql

SCOP Domain Coordinates for d1vrua2:

Click to download the PDB-style file with coordinates for d1vrua2.
(The format of our PDB-style files is described here.)

Timeline for d1vrua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vrua1
View in 3D
Domains from other chains:
(mouse over for more information)
d1vrub1