Lineage for d1gcxa2 (1gcx A:348-758)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86813Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 86814Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 86815Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 86851Protein T4-like DNA polymerase [56680] (5 species)
  7. 86855Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [56685] (1 PDB entry)
  8. 86856Domain d1gcxa2: 1gcx A:348-758 [43014]
    Other proteins in same PDB: d1gcxa1

Details for d1gcxa2

PDB Entry: 1gcx (more details), 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1

SCOP Domain Sequences for d1gcxa2:

Sequence, based on SEQRES records: (download)

>d1gcxa2 e.8.1.1 (A:348-758) T4-like DNA polymerase {Archaeon Pyrococcus kodakaraensis}
stgnlvewfllrkayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkm
katidpierklldyrqraikilansyygyygyararwyckecaesvtawgreyitmtike
ieekygfkviysdtdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgf
fvtkkkyavideegkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevt
eklskyevppeklviheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgs
grigdraipfdefdptkhkydaeyyienqvlpaverilrafgyrkedlryq

Sequence, based on observed residues (ATOM records): (download)

>d1gcxa2 e.8.1.1 (A:348-758) T4-like DNA polymerase {Archaeon Pyrococcus kodakaraensis}
stgnlvewfllrkayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkm
katidpierklldyrqraikilansyygyygyararwyckecaesvtawgreyitmtike
ieekygfkviysdtdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgf
fvtkkkyavideegkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevt
eklskyevppeklviheqiphvavakrlaatvisyivlraipfdefdptkhkydaeyyie
nqvlpaverilrgyrkedlryq

SCOP Domain Coordinates for d1gcxa2:

Click to download the PDB-style file with coordinates for d1gcxa2.
(The format of our PDB-style files is described here.)

Timeline for d1gcxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gcxa1