Lineage for d1tgoa2 (1tgo A:348-773)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86813Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 86814Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 86815Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 86851Protein T4-like DNA polymerase [56680] (5 species)
  7. 86857Species Archaeon Thermococcus gorgonarius [TaxId:71997] [56682] (1 PDB entry)
  8. 86858Domain d1tgoa2: 1tgo A:348-773 [43010]
    Other proteins in same PDB: d1tgoa1

Details for d1tgoa2

PDB Entry: 1tgo (more details), 2.5 Å

PDB Description: thermostable b type dna polymerase from thermococcus gorgonarius

SCOP Domain Sequences for d1tgoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgoa2 e.8.1.1 (A:348-773) T4-like DNA polymerase {Archaeon Thermococcus gorgonarius}
stgnlvewfllrkayernelapnkpderelarrresyaggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkm
katidpiekklldyrqraikilansfygyygyakarwyckecaesvtawgrqyiettire
ieekfgfkvlyadtdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklskyevppeklviyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgs
grigdraipfdefdpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglga
wlkpkt

SCOP Domain Coordinates for d1tgoa2:

Click to download the PDB-style file with coordinates for d1tgoa2.
(The format of our PDB-style files is described here.)

Timeline for d1tgoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tgoa1