Lineage for d1wafb2 (1waf B:376-903)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140913Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 140914Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 140915Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 140951Protein T4-like DNA polymerase [56680] (5 species)
  7. 140961Species Bacteriophage RB69 [TaxId:12353] [56681] (5 PDB entries)
  8. 140967Domain d1wafb2: 1waf B:376-903 [43009]
    Other proteins in same PDB: d1wafa1, d1wafb1

Details for d1wafb2

PDB Entry: 1waf (more details), 3.2 Å

PDB Description: dna polymerase from bacteriophage rb69

SCOP Domain Sequences for d1wafb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wafb2 e.8.1.1 (B:376-903) T4-like DNA polymerase {Bacteriophage RB69}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOP Domain Coordinates for d1wafb2:

Click to download the PDB-style file with coordinates for d1wafb2.
(The format of our PDB-style files is described here.)

Timeline for d1wafb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wafb1