Lineage for d1clqa2 (1clq A:376-903)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86813Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 86814Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 86815Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 86851Protein T4-like DNA polymerase [56680] (5 species)
  7. 86861Species Bacteriophage RB69 [TaxId:12353] [56681] (5 PDB entries)
  8. 86864Domain d1clqa2: 1clq A:376-903 [43006]
    Other proteins in same PDB: d1clqa1

Details for d1clqa2

PDB Entry: 1clq (more details), 2.7 Å

PDB Description: crystal structure of a replication fork dna polymerase editing complex at 2.7 a resolution

SCOP Domain Sequences for d1clqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clqa2 e.8.1.1 (A:376-903) T4-like DNA polymerase {Bacteriophage RB69}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOP Domain Coordinates for d1clqa2:

Click to download the PDB-style file with coordinates for d1clqa2.
(The format of our PDB-style files is described here.)

Timeline for d1clqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clqa1