Lineage for d1xwl_2 (1xwl 469-876)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200579Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 200580Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 200581Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 200582Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 200583Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (4 PDB entries)
  8. 200584Domain d1xwl_2: 1xwl 469-876 [43001]
    Other proteins in same PDB: d1xwl_1

Details for d1xwl_2

PDB Entry: 1xwl (more details), 1.7 Å

PDB Description: bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment

SCOP Domain Sequences for d1xwl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwl_2 e.8.1.1 (469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d1xwl_2:

Click to download the PDB-style file with coordinates for d1xwl_2.
(The format of our PDB-style files is described here.)

Timeline for d1xwl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xwl_1