Lineage for d3ktqa2 (3ktq A:423-831)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016467Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 3016533Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)
  8. 3016549Domain d3ktqa2: 3ktq A:423-831 [42989]
    Other proteins in same PDB: d3ktqa1
    protein/DNA complex; complexed with dct, mg

Details for d3ktqa2

PDB Entry: 3ktq (more details), 2.3 Å

PDB Description: crystal structure of an active ternary complex of the large fragment of dna polymerase i from thermus aquaticus
PDB Compounds: (A:) protein (large fragment of DNA polymerase I)

SCOPe Domain Sequences for d3ktqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktqa2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsak

SCOPe Domain Coordinates for d3ktqa2:

Click to download the PDB-style file with coordinates for d3ktqa2.
(The format of our PDB-style files is described here.)

Timeline for d3ktqa2: