Lineage for d1dk4a_ (1dk4 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246418Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2246419Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2246420Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2246429Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (4 species)
  7. 2246441Species Methanococcus jannaschii [TaxId:2190] [56666] (3 PDB entries)
    MJ0109
    structural genomics
  8. 2246446Domain d1dk4a_: 1dk4 A: [42970]
    complexed with po4, zn

Details for d1dk4a_

PDB Entry: 1dk4 (more details), 2.6 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d1dk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk4a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Methanococcus jannaschii [TaxId: 2190]}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

SCOPe Domain Coordinates for d1dk4a_:

Click to download the PDB-style file with coordinates for d1dk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk4a_: