Lineage for d1dk4a_ (1dk4 A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38091Fold e.7: Sugar phosphatases [56654] (1 superfamily)
  4. 38092Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 38093Family e.7.1.1: Sugar phosphatases [56656] (5 proteins)
  6. 38097Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (1 species)
  7. 38098Species Methanococcus jannaschii, MJ0109 [56666] (1 PDB entry)
  8. 38099Domain d1dk4a_: 1dk4 A: [42970]

Details for d1dk4a_

PDB Entry: 1dk4 (more details), 2.6 Å

PDB Description: crystal structure of mj0109 gene product inositol monophosphatase

SCOP Domain Sequences for d1dk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk4a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Methanococcus jannaschii, MJ0109}
mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
skemldiildll

SCOP Domain Coordinates for d1dk4a_:

Click to download the PDB-style file with coordinates for d1dk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk4a_: