Lineage for d2hhmb_ (2hhm B:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.7: Sugar phosphatases [56654] (1 superfamily) Superfamily e.7.1: Sugar phosphatases [56655] (1 family) 
Family e.7.1.1: Sugar phosphatases [56656] (5 proteins) 
Protein Inositol monophosphatase [56663] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries) 
Domain d2hhmb_: 2hhm B: [42956]
Details for d2hhmb_
PDB Entry: 2hhm (more details), 2.1 Å
PDB Description: structure of inositol monophosphatase, the putative target of lithium therapy
SCOP Domain Sequences for d2hhmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhmb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdde
SCOP Domain Coordinates for d2hhmb_:
Click to download the PDB-style file with coordinates for d2hhmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hhmb_:
- d2hhmb_ appears in SCOP 1.57
- d2hhmb_ appears in the current release, SCOPe 2.08
View in 3D
