Lineage for d1ivha2 (1ivh A:6-241)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691655Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1691656Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1691657Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1691692Protein Isovaleryl-coa dehydrogenase, NM domains [56652] (1 species)
  7. 1691693Species Human (Homo sapiens) [TaxId:9606] [56653] (1 PDB entry)
  8. 1691694Domain d1ivha2: 1ivh A:6-241 [42869]
    Other proteins in same PDB: d1ivha1, d1ivhb1, d1ivhc1, d1ivhd1
    complexed with cos, fad

Details for d1ivha2

PDB Entry: 1ivh (more details), 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity
PDB Compounds: (A:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d1ivha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
vddainglseeqrqlrqtmakflqehlapkaqeidrsnefknlrefwkqlgnlgvlgita
pvqyggsglgylehvlvmeeisrasgavglsygahsnlcinqlvrngneaqkekylpkli
sgeyigalamsepnagsdvvsmklkaekkgnhyilngnkfwitngpdadvlivyaktdla
avpasrgitafivekgmpgfstskkldklgmrgsntcelifedckipaanilghen

SCOPe Domain Coordinates for d1ivha2:

Click to download the PDB-style file with coordinates for d1ivha2.
(The format of our PDB-style files is described here.)

Timeline for d1ivha2: