Lineage for d1egeb2 (1ege B:10-241)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015485Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 3015526Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 3015527Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
    Uniprot P11310 34-421
  8. 3015541Domain d1egeb2: 1ege B:10-241 [42866]
    Other proteins in same PDB: d1egea1, d1egeb1, d1egec1, d1eged1
    complexed with fad; mutant

Details for d1egeb2

PDB Entry: 1ege (more details), 2.75 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase
PDB Compounds: (B:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d1egeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egeb2 e.6.1.1 (B:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOPe Domain Coordinates for d1egeb2:

Click to download the PDB-style file with coordinates for d1egeb2.
(The format of our PDB-style files is described here.)

Timeline for d1egeb2: