Lineage for d1egcd2 (1egc D:10-241)
- Root: SCOP 1.57
Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds) 
Fold e.6: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56644] (1 superfamily) Superfamily e.6.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56645] (1 family) 
Family e.6.1.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56646] (3 proteins) Protein Medium chain acyl-CoA dehydrogenase [56649] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56651] (3 PDB entries) 
Domain d1egcd2: 1egc D:10-241 [42864]
Other proteins in same PDB: d1egca1, d1egcb1, d1egcc1, d1egcd1
Details for d1egcd2
PDB Entry: 1egc (more details), 2.6 Å
PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa
SCOP Domain Sequences for d1egcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egcd2 e.6.1.1 (D:10-241) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd
SCOP Domain Coordinates for d1egcd2:
Click to download the PDB-style file with coordinates for d1egcd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egcd2:
View in 3D
