Lineage for d1egdd2 (1egd D:10-241)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86656Fold e.6: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56644] (1 superfamily)
  4. 86657Superfamily e.6.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56645] (1 family) (S)
  5. 86658Family e.6.1.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56646] (3 proteins)
  6. 86669Protein Medium chain acyl-CoA dehydrogenase [56649] (2 species)
  7. 86670Species Human (Homo sapiens) [TaxId:9606] [56651] (3 PDB entries)
  8. 86674Domain d1egdd2: 1egd D:10-241 [42860]
    Other proteins in same PDB: d1egda1, d1egdb1, d1egdc1, d1egdd1

Details for d1egdd2

PDB Entry: 1egd (more details), 2.4 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egdd2 e.6.1.1 (D:10-241) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d1egdd2:

Click to download the PDB-style file with coordinates for d1egdd2.
(The format of our PDB-style files is described here.)

Timeline for d1egdd2: