Lineage for d3mddb2 (3mdd B:11-241)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015485Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 3015526Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 3015548Species Pig (Sus scrofa) [TaxId:9823] [56650] (3 PDB entries)
  8. 3015556Domain d3mddb2: 3mdd B:11-241 [42854]
    Other proteins in same PDB: d3mdda1, d3mddb1
    complexed with fad

Details for d3mddb2

PDB Entry: 3mdd (more details), 2.4 Å

PDB Description: crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate
PDB Compounds: (B:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d3mddb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mddb2 e.6.1.1 (B:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]}
gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltge

SCOPe Domain Coordinates for d3mddb2:

Click to download the PDB-style file with coordinates for d3mddb2.
(The format of our PDB-style files is described here.)

Timeline for d3mddb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mddb1