Lineage for d2cae__ (2cae -)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140660Fold e.5: Heme-linked catalases [56633] (1 superfamily)
  4. 140661Superfamily e.5.1: Heme-linked catalases [56634] (1 family) (S)
  5. 140662Family e.5.1.1: Heme-linked catalases [56635] (2 proteins)
  6. 140663Protein Catalase I [56636] (5 species)
  7. 140704Species Proteus mirabilis [TaxId:584] [56640] (5 PDB entries)
  8. 140706Domain d2cae__: 2cae - [42810]

Details for d2cae__

PDB Entry: 2cae (more details), 2.2 Å

PDB Description: catalase

SCOP Domain Sequences for d2cae__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cae__ e.5.1.1 (-) Catalase I {Proteus mirabilis}
kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvl

SCOP Domain Coordinates for d2cae__:

Click to download the PDB-style file with coordinates for d2cae__.
(The format of our PDB-style files is described here.)

Timeline for d2cae__: