Lineage for d7cata_ (7cat A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570066Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2570067Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2570068Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2570069Protein Catalase I [56636] (8 species)
  7. 2570075Species Cow (Bos taurus) [TaxId:9913] [56637] (6 PDB entries)
  8. 2570092Domain d7cata_: 7cat A: [42781]
    complexed with hem, ndp

Details for d7cata_

PDB Entry: 7cat (more details), 2.5 Å

PDB Description: The NADPH binding site on beef liver catalase
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d7cata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cata_ e.5.1.1 (A:) Catalase I {Cow (Bos taurus) [TaxId: 9913]}
nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
dvhpeygsriqalldkyn

SCOPe Domain Coordinates for d7cata_:

Click to download the PDB-style file with coordinates for d7cata_.
(The format of our PDB-style files is described here.)

Timeline for d7cata_: