Lineage for d1ei5a3 (1ei5 A:3-335)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37843Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 37844Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 37845Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 37941Protein D-aminopeptidase, N-terminal domain [56626] (1 species)
  7. 37942Species Ochrobactrum anthropi [TaxId:529] [56627] (1 PDB entry)
  8. 37943Domain d1ei5a3: 1ei5 A:3-335 [42772]
    Other proteins in same PDB: d1ei5a1, d1ei5a2

Details for d1ei5a3

PDB Entry: 1ei5 (more details), 1.9 Å

PDB Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi

SCOP Domain Sequences for d1ei5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei5a3 e.3.1.1 (A:3-335) D-aminopeptidase, N-terminal domain {Ochrobactrum anthropi}
kfdtsaleafvrhipqnykgpggvvavvkdgevvlqhawgfadlrtrtpmtldtrmpics
vskqftcavlldavgepellddaleayldkfederpavrdlcnnqsglrdywalsvlcga
dpegvflpaqaqsllrrlktthfepgshysycngnfriladlieahtgrtlvdilserif
apagmkraelisdtalfdectgyegdtvrgflpatnriqwmgdagicaslndmiaweqfi
datrddesglyrrlsgpqtfkdgvaapygfglnlhetggkrltghggalrgwrcqrwhca
derlstiamfnfeggasevafklmnialgvsss

SCOP Domain Coordinates for d1ei5a3:

Click to download the PDB-style file with coordinates for d1ei5a3.
(The format of our PDB-style files is described here.)

Timeline for d1ei5a3: