SCOP 1.73: Domain d1fofb_: 1fof B:

Lineage for d1fofb_ (1fof B:)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (12 PDB entries)

8. Domain d1fofb_: 1fof B: [42764]
   complexed with co, so4

Details for d1fofb_

PDB Entry: 1fof, 2 Å

PDB Description: crystal structure of the class d beta-lactamase oxa-10

PDB Compounds: (B:) beta lactamase oxa-10

SCOP Domain Sequences for d1fofb_:

Sequence; same for both SEQRES and ATOM records:

>d1fofb_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle
tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaape
ylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkime
segiig

Timeline for d1fofb_:

• d1fofb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fofb_ appears in SCOP 1.71
  
• d1fofb_ appears in SCOP 1.75
  
• d1fofb_ appears in the current release, SCOPe 2.08