Lineage for d2blsb_ (2bls B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690268Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1690287Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (95 PDB entries)
  8. 1690464Domain d2blsb_: 2bls B: [42748]

Details for d2blsb_

PDB Entry: 2bls (more details), 2 Å

PDB Description: ampc beta-lactamase from escherichia coli
PDB Compounds: (B:) ampc beta-lactamase

SCOPe Domain Sequences for d2blsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2blsb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnal

SCOPe Domain Coordinates for d2blsb_:

Click to download the PDB-style file with coordinates for d2blsb_.
(The format of our PDB-style files is described here.)

Timeline for d2blsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2blsa_