Lineage for d1c3bb_ (1c3b B:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) 
Protein AMPC beta-Lactamase, class C [56618] (3 species) 
Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (6 PDB entries) 
Domain d1c3bb_: 1c3b B: [42744]
Details for d1c3bb_
PDB Entry: 1c3b (more details), 2.25 Å
PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor, benzo(b)thiophene-2-boronic acid (bzb)
SCOP Domain Sequences for d1c3bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3bb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
SCOP Domain Coordinates for d1c3bb_:
Click to download the PDB-style file with coordinates for d1c3bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3bb_:
- d1c3bb_ appears in SCOP 1.57
- d1c3bb_ appears in the current release, SCOPe 2.08
View in 3D
