SCOPe 2.07: Domain d1blsb_: 1bls B:

Lineage for d1blsb_ (1bls B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (10 PDB entries)
   Uniprot P05364 22-380 ! Uniprot P05364 22-381

8. Domain d1blsb_: 1bls B: [42742]
   complexed with ipp

Details for d1blsb_

PDB Entry: 1bls, 2.3 Å

PDB Description: crystallographic structure of a phosphonate derivative of the enterobacter cloacae p99 cephalosporinase: mechanistic interpretation of a beta-lactamase transition state analog

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1blsb_:

Sequence; same for both SEQRES and ATOM records:

>d1blsb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

Timeline for d1blsb_:

• d1blsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1blsb_ appears in SCOPe 2.06
  
• d1blsb_ appears in the current release, SCOPe 2.08