Lineage for d1blsb_ (1bls B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37843Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 37844Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 37845Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 37846Protein AMPC beta-Lactamase, class C [56618] (3 species)
  7. 37852Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (3 PDB entries)
  8. 37857Domain d1blsb_: 1bls B: [42742]

Details for d1blsb_

PDB Entry: 1bls (more details), 2.3 Å

PDB Description: crystallographic structure of a phosphonate derivative of the enterobacter cloacae p99 cephalosporinase: mechanistic interpretation of a beta-lactamase transition state analog
PDB Compounds: (B:)

SCOP Domain Sequences for d1blsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blsb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

SCOP Domain Coordinates for d1blsb_:

Click to download the PDB-style file with coordinates for d1blsb_.
(The format of our PDB-style files is described here.)

Timeline for d1blsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1blsa_